Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647350.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
ESMDELLKMDTQTLLQHRNFKFRMLGGFQEGISVPSEKKRNMKKKEPIVQRAEFSRTPDLELEDEVEKLKQQILKARESSPKPAQSTNLGLNEMIEKLKREVDLEFTEAVKTMGLEGKLK ALREEFTKIRSTSNQTVDPGLKDKIDELSQEFSHGLSGAPNYSSLNLKLDMLKEMSQAKKLAEQNEKVVALKQEINKKFDEIMERSDVKEKIEALKADIAHAGSPDQGVLEQDLKERILK TKKE | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,927.731 | ||
Theoretical pI: | 6.489 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 41.645 | ||
aromaticity | 0.037 | ||
GRAVY | -0.851 | ||
Secondary Structure Fraction | |||
Helix | 0.242 | ||
turn | 0.184 | ||
sheet | 0.340 |