Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647357.1	5prime_partial	225	3-680(+)
Amino Acid sequence :
RRFEIPVSEMIFGGMTKADLSEAQEKELQLVQQDRIIEQTKNQKNALEGYVYDMRNKLFNTYRSFATDSEREDISRSLQQTEDWLYEDGDDESEKVYVGKLDNLKKLVDPIENRYKDEEA RARATRDLLKCVVDNRMAAKSLPSSDKDVVLNECFKAEQWLREKTQQQDSLPKNTDPILWSSEIRRKTELLDKTCKQILRSKSPFKREDTSDSNQPNSPDKQETD*
Physicochemical properties
Number of amino acids:		225
Molecular weight:		26,368.062
Theoretical pI:		5.046
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		25440 25565
Instability index:		65.013
aromaticity		0.067
GRAVY		-1.129
Secondary Structure Fraction
Helix		0.240
turn		0.187
sheet		0.253