Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647361.1 | internal | 152 | 1-456(+) |
Amino Acid sequence : | |||
RKWITKAWASFTCLFFLLVELQMCTCFAEISAQQQRKLDRVHLLPGQSFDVDFAHYSGYVTVDEEAGRALFYWFVEASRDSTVKPLVLWLNGGPGCSSVGYGEAMEIGPFHVNNNGKTHH LNRYSWNQVANLLFIDTPVGTGYSYSNDSLDV | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 13,818.313 | ||
Theoretical pI: | 10.827 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 77.170 | ||
aromaticity | 0.050 | ||
GRAVY | -0.462 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.300 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647361.1 | 3prime_partial | 120 | 360-1(-) |
Amino Acid sequence : | |||
MVSLPVIVNMKWTNLHCLTISHRRTARPSIEPKNQRLNGRVPRSLNKPIEQSPSRFLINSHIPRIMSKVHIEGLPRKQMNPVQLPLLLCGNFSKASAHLKLNKKEKQTCKRSPCFCYPFP | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,818.313 | ||
Theoretical pI: | 10.827 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 77.170 | ||
aromaticity | 0.050 | ||
GRAVY | -0.462 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.300 | ||
sheet | 0.200 |