Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647362.1 | internal | 257 | 2-772(+) |
Amino Acid sequence : | |||
GKLPNYVVVEQRYLDTKLIPANDDHPSHDVSEGQKLVKEVYETLRGSPQWNETLLVVTYDEHGGFFDHVPTPINGVPSPDGVVGPDPFFFGFDRLGVRVPTLFISPWIEKGTVVHGPNGS PFPTSEYEHSSIPATVKKIFNIPTFLTKRDEWAGTFESVLTRTEPRTDCPVELPTPTKMKQGEPDVERHISEFQQELVQLAAVLKGDHTFTTYPEKIGKQMSVKEANEYMEDAVKRFFEA GVAAKKMGVDGEQIVQM | |||
Physicochemical properties | |||
Number of amino acids: | 257 | ||
Molecular weight: | 28,801.183 | ||
Theoretical pI: | 5.143 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 45.466 | ||
aromaticity | 0.097 | ||
GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.241 | ||
sheet | 0.206 |