Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647376.1 | internal | 243 | 3-731(+) |
Amino Acid sequence : | |||
LKMCPTTTDDDDEITHNPSDRKPRYKRRKIAIFLAYCGVGYQGMQKNPGAKTIEGELEEALYHSGAVPESDRGIPKRFDWARAARTDKGVSAVGQVVSGRFYVDPPGLVDRLNSILPLQI RIFGYKRVTASFNAKKFCDRRRYVYLVPVFSLDPNAHRDRESVLTSVGSENELVKCLECSERGRKVAGVMGRRNCESRVTESEAKSVTEPSTIAVNSDVVEVSNTETGLEVEKSGLVMET RIT | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 15,157.077 | ||
Theoretical pI: | 6.731 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 38.094 | ||
aromaticity | 0.101 | ||
GRAVY | -0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.246 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647376.1 | complete | 138 | 473-57(-) |
Amino Acid sequence : | |||
MRIRIERKHRDKINIPSAIAKLLRIERSSDALVPKDSNLQWENRVEPVDEAGRVDVEPTGDNLTDGANAFVGAGSASPIKAFRDASIGFGDGARMVKGFFKFSFYGFGAWVFLHALVANA AICEENCDFPPFVSRLAV* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,157.077 | ||
Theoretical pI: | 6.731 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 38.094 | ||
aromaticity | 0.101 | ||
GRAVY | -0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.246 | ||
sheet | 0.254 |