Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647382.1 | internal | 200 | 1-600(+) |
Amino Acid sequence : | |||
DDRIPQCGCARHGVAAPPAQPFIKSLKTALKETFFPDDPLRQFKNQPLSRKLVLGVQYFFPILEWAPRYTLQHFKSDLIAGITIATLAIPQGISYAKLTNLPPIVGLYSSFVPPLVYAMM GSSRDLAVGTVAVVSLLMGTMLENEVNPKEQPTLYLHLAFTATFFAGLFQAALGLFRLGFIVDFLSHATIEGFMAGAATV | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 21,834.349 | ||
Theoretical pI: | 8.589 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 25.812 | ||
aromaticity | 0.115 | ||
GRAVY | 0.392 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.220 | ||
sheet | 0.295 |