Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647384.1	internal	225	2-676(+)
Amino Acid sequence :
YPGIDGHPPPGSAPLIENFSLSFNSGDRCLLVGSNGAGKTTILRILGGKHMVEPHMVRVLGRSAFHDTTLTSSGELCYLGGEWKRDVAFAGFEVSIQMDVSAEKMIFGVSGIDPERRAAL IKVLGIDLSWRMHKASDGQRRRVQICMGLLKPFKVLLLDEITIDLDVLARADLLKFLKEECQERGATIIYATHIFDGLEDWPSHIVYVAHGKLQLAMPMDKAKEI
Physicochemical properties
Number of amino acids:		225
Molecular weight:		24,842.608
Theoretical pI:		6.479
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22710
Instability index:		42.813
aromaticity		0.071
GRAVY		0.013
Secondary Structure Fraction
Helix		0.324
turn		0.218
sheet		0.280