Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647397.1 | internal | 226 | 1-678(+) |
Amino Acid sequence : | |||
KKKKKSKMSSNSGEGKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDLTDPKKTEHLNVLPGANERLKLFKANLLEEGSFDSVVEGCEGVFHTASPFFNTATDPEAELIEPAVKGTLNV LSSCAKTPSVKRVVVTSSMAAVVYNGKPRAPELVIDETWFSDPDFCKEVKNWYVLSKTLADDAAWKFAKEKGLDIVTINPAMVIGPLLQPTLNTSAAAVLNLINGS | |||
Physicochemical properties | |||
Number of amino acids: | 226 | ||
Molecular weight: | 14,075.744 | ||
Theoretical pI: | 9.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 19.176 | ||
aromaticity | 0.120 | ||
GRAVY | 0.212 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.271 | ||
sheet | 0.203 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647397.1 | 5prime_partial | 133 | 677-276(-) |
Amino Acid sequence : | |||
DPFIKFRTAAALVFKVGCKSGPITIAGFIVTISRPFSFANFHAASSAKVFDNTYQFFTSLQKSGSENQVSSITNSGARGFPLYTTAAMEDVTTTLLTDGVFAQELRTFRVPFTAGSINSA SGSVAVLKNGDAV* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 14,075.744 | ||
Theoretical pI: | 9.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 19.176 | ||
aromaticity | 0.120 | ||
GRAVY | 0.212 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.271 | ||
sheet | 0.203 |