Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647399.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
LQSNLLTTVIIITSFGLFVLSFYYVLWKAIRTGNKRNCSNPKAPEAAGGWPILGHLHLFRGQGLLLHKIFGAMAEKHGPAFTIRLGMRPALVVSNWEVAKECFTANDRALASRPTSLALK IMGYNNSLFAFAPYGQYWRELRKIVMHQLLSSRRLELLKNVWLSEIDIWIKGLYENSLVNKVVDMKQWFGELMMNIVVRLVAGKRSFGKIREGDSEEAKAHQRQIKALRDFFRLVEVFMI EDAFPFLTWLDPRGYQ | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 29,434.199 | ||
Theoretical pI: | 9.893 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 54430 54555 | ||
Instability index: | 40.692 | ||
aromaticity | 0.121 | ||
GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
Helix | 0.375 | ||
turn | 0.207 | ||
sheet | 0.293 |