Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647403.1	internal	238	1-714(+)
Amino Acid sequence :
AGMALIVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRSEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYW WCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKVPDPASTDNAEFQIVLGIIRDGLKVDPKRYHKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKT
Physicochemical properties
Number of amino acids:		238
Molecular weight:		26,043.250
Theoretical pI:		4.916
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		33460 33710
Instability index:		46.674
aromaticity		0.071
GRAVY		-0.245
Secondary Structure Fraction
Helix		0.273
turn		0.206
sheet		0.294