Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647409.1 | internal | 258 | 3-776(+) |
Amino Acid sequence : | |||
TFFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIA VGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVY RNLFDALVDSVYASLEKA | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 28,646.460 | ||
Theoretical pI: | 9.158 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.323 | ||
aromaticity | 0.105 | ||
GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.287 | ||
sheet | 0.213 |