Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647422.1 | 3prime_partial | 202 | 89-694(+) |
Amino Acid sequence : | |||
MFTGSVIQVLSLAVGINYGQIANNLPSPSRVAALLRSININRVKLYDADPNVLQAFSNTNVEFIVSVGNEYILNMTDLTKAQDWLKLHIQPYIPQTKITCITVGNEVLSGNDRQLMSNLL PAMQTMHSALVSLGWDKEVYVSTAHSLQILAYSFPPSSGLFRQDLGQYIQPLLNFHSQVNSPFLINAYPYFAYKDNPNEVSL | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,509.499 | ||
Theoretical pI: | 6.030 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
Instability index: | 41.183 | ||
aromaticity | 0.099 | ||
GRAVY | 0.055 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.287 | ||
sheet | 0.238 |