Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647433.1 | 5prime_partial | 203 | 2-613(+) |
Amino Acid sequence : | |||
RNQCSYTIWAAALPGGGQQLNQGQSWTFNVANGTRTGRIWARTKCNFDAPGGTTTRPRCETGDCGAVLRCQTDGATPKTLVEYALNQFNNMDLYDISLIDGFNVPVELSPVTTTATCRSV RCAADITAECPAQLRVPGGCNHPCNVFKSDEYCCNSGSVCVPTNYSRFFKSRCPEAYSFPTPDGPTSTLVCAGGTNYRVVFCP* | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 21,913.396 | ||
Theoretical pI: | 7.911 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27930 | ||
Instability index: | 28.204 | ||
aromaticity | 0.094 | ||
GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
Helix | 0.236 | ||
turn | 0.291 | ||
sheet | 0.163 |