Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647444.1	3prime_partial	224	84-755(+)
Amino Acid sequence :
MVSTGGGGAALLAERKVSFRSDSFSDETVPETGCLSIIVLGASGDLAKKKTFPALWNLYRGGFLQSNEVHIFGYARTKITDDELRDRISGYLVDNHGASSEHSEDLLKFLQLIKYVNGSY DSEEGFRLLDKEISAHEVSKNTQEGTSRRLFYLALPPSVYPSVCKMIRNFCMNKSNLGGWTRVVVEKPFGKDLDSAEELSSQLGELFDEKQIYRIDHYLGKELV
Physicochemical properties
Number of amino acids:		224
Molecular weight:		25,031.969
Theoretical pI:		5.612
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24410 24535
Instability index:		48.564
aromaticity		0.098
GRAVY		-0.337
Secondary Structure Fraction
Helix		0.321
turn		0.254
sheet		0.259