Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647444.1 | 3prime_partial | 224 | 84-755(+) |
Amino Acid sequence : | |||
MVSTGGGGAALLAERKVSFRSDSFSDETVPETGCLSIIVLGASGDLAKKKTFPALWNLYRGGFLQSNEVHIFGYARTKITDDELRDRISGYLVDNHGASSEHSEDLLKFLQLIKYVNGSY DSEEGFRLLDKEISAHEVSKNTQEGTSRRLFYLALPPSVYPSVCKMIRNFCMNKSNLGGWTRVVVEKPFGKDLDSAEELSSQLGELFDEKQIYRIDHYLGKELV | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 25,031.969 | ||
Theoretical pI: | 5.612 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
Instability index: | 48.564 | ||
aromaticity | 0.098 | ||
GRAVY | -0.337 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.254 | ||
sheet | 0.259 |