Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647445.1 | 5prime_partial | 229 | 1-690(+) |
Amino Acid sequence : | |||
HISQAATKMALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC RVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDMAAQQQHEAELLAAAAQPLPDDDDDAFE* | |||
Physicochemical properties | |||
Number of amino acids: | 229 | ||
Molecular weight: | 19,915.444 | ||
Theoretical pI: | 9.149 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 39.293 | ||
aromaticity | 0.046 | ||
GRAVY | 0.161 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.206 | ||
sheet | 0.263 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647445.1 | complete | 175 | 558-31(-) |
Amino Acid sequence : | |||
MEVRIPCKLSGKIKERFLKVVVALRRDLIVLQILLPVERDLLSFHLPVLDVNFVSTENNRDVLTYPAKIPMPCRNILICQTSSDIKHNNSTLPMNVISISKSTKLLLTGCIPAIESNLST VREEIQRMNFHTNGRLVFLLKLSGKMPFHERSLTCAAITDDHKLEARIIDCLLVW* | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 19,915.444 | ||
Theoretical pI: | 9.149 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 39.293 | ||
aromaticity | 0.046 | ||
GRAVY | 0.161 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.206 | ||
sheet | 0.263 |