Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647450.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
RSTSSPTVVDVPLGSRSYPIYIGSGLLNQPDLLQRHVHGKRVLVVTNTTVAPLYLDKVVNALTHGNPSVSVESVILPDGENYKNMDTLMKVFDKAIESRFDRRATFVALGGGVIGDMCGF AAAAFLRGVNFIQIPTTVMAQVDSSVGGKTGINHPLGKNLIGAFYQPQCVLVDTDTLNTLPDRELASGLAEVVKYGLIRDVEFFEWQEKNMPALLARDPDAFAYAIKRSCENKAEVVSL | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 25,955.471 | ||
Theoretical pI: | 6.111 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 35.561 | ||
aromaticity | 0.075 | ||
GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.247 | ||
sheet | 0.243 |