Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647454.1 | 5prime_partial | 182 | 2-550(+) |
Amino Acid sequence : | |||
AHSLRQFYRECVITGTVDFIFGNGAVVLQNCLILARKPLPEQKNSITAQGRKDPNQNTGFSIQFCNISADSDLLASPNSTATYLGRPWKEYSKTVFMQSYMSSVIRPEGWLEWQGDFALD TLFYGEYMNYGPGAALNNRVKWPGFHPMNDSSQATSFTVTQFIDGNLWLPSTGVKFTAGLAI* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 20,281.672 | ||
Theoretical pI: | 6.947 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38055 | ||
Instability index: | 36.812 | ||
aromaticity | 0.132 | ||
GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.286 | ||
sheet | 0.209 |