Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647455.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
LNQVGLTSLQSGMDNVRNPVGNPIAGIDPLEIVDTRPYTNLLSQFITANSRGNPSVSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAVKNGKFGFNLLVGGFFSPKRCEEAVPLDAWVPA DDVIPVCKAVLEAYRDLGNRGNRQKTRMMWLIDELGIEGFRSEVVKRMPGEELERSSEEDLVQKQWERREYLGVHPQKQEGHSFVGLHIPVGRVQADDMDELAWLADKYGSGELRLTVEQ NVIIPNIENSKL | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 28,312.791 | ||
Theoretical pI: | 5.329 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
Instability index: | 46.965 | ||
aromaticity | 0.071 | ||
GRAVY | -0.408 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.270 | ||
sheet | 0.250 |