Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647477.1	internal	279	1-837(+)
Amino Acid sequence :
AELGGLVGLRKPDNHGVPYSLTEEFVSVYRMHPLLPDDLDVRDISATPGLNKSPPLIKKVPMSNMIGLKGEKALAEIGFTRQMVSMGHQSCGSLELWNYPTWLRDLVAQDKDGKDRPDHV DLASLEIYRDRERSVARYNEFRRGVMLIPISKWEDLTDNVETISVLRDVYGDDVEELDLLVGLMAEKKIKGYAISETAFVVFIAMATRRLQADLFFTSQFNEETYTKKGLEWVNTTENLK DVLARHHPEMSEKWINSDSAFSVWDAPPAPHNPIPLLLR
Physicochemical properties
Number of amino acids:		279
Molecular weight:		31,681.800
Theoretical pI:		5.259
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		44920 44920
Instability index:		40.725
aromaticity		0.082
GRAVY		-0.348
Secondary Structure Fraction
Helix		0.319
turn		0.222
sheet		0.283