Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647493.1 | 3prime_partial | 219 | 65-721(+) |
Amino Acid sequence : | |||
MPIESSIPTPLGPAACEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPT IQEELDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKARPYDPYMVYTSPNEAILCTDSYQSMYTQMFRGLYH | |||
Physicochemical properties | |||
Number of amino acids: | 219 | ||
Molecular weight: | 24,830.141 | ||
Theoretical pI: | 6.113 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 20985 | ||
Instability index: | 60.305 | ||
aromaticity | 0.096 | ||
GRAVY | -0.384 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.228 | ||
sheet | 0.269 |