Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647504.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
LEVKPWIKTSLAPGSGVVTKYLLQSGLQKYLDQQGFNIVGYGCTTCIGNSGEIDDSVGAAISENDIIAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVNIDFEKEPIGVGKD GKSVYFKDIWPSTEEIAEVVQSSVLSDMFKSTYRSITTGNPMWNELSVPANTLYSWDVSSTYIHEPPYFKNMTMEPPGPHGVKDAYCLLNFGDSITTDHISPAGSIHKDSPAAKYLLERG VDRKD | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 26,627.684 | ||
Theoretical pI: | 5.128 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39880 40005 | ||
Instability index: | 39.868 | ||
aromaticity | 0.094 | ||
GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.294 | ||
sheet | 0.212 |