Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647505.1	5prime_partial	238	3-719(+)
Amino Acid sequence :
HEHGHSGEVWFGAEVMDIVATWTKNLCINVSQGHLENLADNVNYESESVEQLSSDLSMWNVLDIGTGNGLLLHELAKRGFNDLTGTDYSEGAIDLARNLAERDGFNNIKFLVDDVLETKL AEQFKLVMDKGALDAIGLHPDGSIKRIMYWESVTRLVAPGGVLVITSCNHTKDELVQEVETFNQRRVSSTPEPEAPKDQEACKDPSLFRYLSHVRSYPTFMFGGSEGSRVATVAFLRS*
Physicochemical properties
Number of amino acids:		238
Molecular weight:		12,467.396
Theoretical pI:		10.252
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27500 27625
Instability index:		53.974
aromaticity		0.102
GRAVY		-0.456
Secondary Structure Fraction
Helix		0.287
turn		0.231
sheet		0.231

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647505.1	3prime_partial	108	424-747(+)
Amino Acid sequence :
MAQSKGSCTGNQSRGWLLQVEFWLSLHAITPKTNWCKRWKLSTKEGSVLHLNQKPQRIKKHAKILLFSDTSAMSAHILHSCLEDQRDRAWPPLHSFGARKKPFPVFLF
Physicochemical properties
Number of amino acids:		108
Molecular weight:		12,467.396
Theoretical pI:		10.252
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27500 27625
Instability index:		53.974
aromaticity		0.102
GRAVY		-0.456
Secondary Structure Fraction
Helix		0.287
turn		0.231
sheet		0.231