Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647507.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
VAPYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVIT DSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYN QNLINHVRNGTPKRP | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 28,240.641 | ||
Theoretical pI: | 9.421 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31860 | ||
Instability index: | 46.457 | ||
aromaticity | 0.098 | ||
GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.318 | ||
sheet | 0.184 |