Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647518.1 | internal | 271 | 2-814(+) |
Amino Acid sequence : | |||
ISRSTSFLHVTLDINLPLWCISVALLVIVAVIYSLKLIFYFEAVRREYYHPIRVNFFFAPWIALMFLFLGVPPSITKNLHTALWYVLMAPIFCLELKIYGQWMSGGQRRLSKVANPSNHL SIVGNFVGALLGASMGLKEGPLFFFAVGIAHYTVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWANIQGSFDYGSRISYFIALFLYFSLAVRVNFFRGFRFSLAWWAYTFPMT GASIATIKYSNEVMNPFTRSLSVLLSIISTL | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 30,752.011 | ||
Theoretical pI: | 9.754 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57870 57995 | ||
Instability index: | 28.724 | ||
aromaticity | 0.173 | ||
GRAVY | 0.703 | ||
Secondary Structure Fraction | |||
Helix | 0.461 | ||
turn | 0.232 | ||
sheet | 0.269 |