Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647533.1 | internal | 216 | 1-648(+) |
Amino Acid sequence : | |||
TPAEDLPKTVHAMYSLKAAMKWDEDVFGLEYDLDLFNIVAVPDFNMGAMENKSLNIFNSKLVLASPETASDGDYAAILGVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSSDM GSRTVKRIADVSRLRNYQFPQDAGPMAHPVRPHSYIKMDNFYTVTVYEKGAEVVRMYKTLLGSEGFRKGMDVYFQRHDGQAVTCEDFFAAMRDANG | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 24,555.458 | ||
Theoretical pI: | 5.356 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 33.393 | ||
aromaticity | 0.125 | ||
GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.208 | ||
sheet | 0.255 |