Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647537.1	internal	228	686-3(-)
Amino Acid sequence :
CTGVSCKIERNDNGSYRVKISANATKTVAELRKPLEQLMKGKTINHASLTPSMMQLLLTRDGISLCKSLQRETGTYILFDRQNLNVRIFGPHGMVSVVERRLLQALCTLNEKSQLEIRLR GRHLPQNLMKHVVEKFGPDLHRLKELVLGTELTLNIRRHLLLVKGSKESKQRVEEIIRDTACSLGGCDPVEQPAGETTCPICLCEVDDEWYQLESLVAETLFCSQILG
Physicochemical properties
Number of amino acids:		228
Molecular weight:		11,316.638
Theoretical pI:		10.653
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12740
Instability index:		69.505
aromaticity		0.058
GRAVY		-0.343
Secondary Structure Fraction
Helix		0.252
turn		0.369
sheet		0.126

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647537.1	5prime_partial	103	1-312(+)
Amino Acid sequence :
GPKICEQNRVSATSDSSWYHSSSTSHRQIGHVVSPAGCSTGSQPPREHAVSRIISSTLCLDSLLPLTRRRWRRILSVNSVPSTNSLSLCRSGPNFSTTCFIRF*
Physicochemical properties
Number of amino acids:		103
Molecular weight:		11,316.638
Theoretical pI:		10.653
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12740
Instability index:		69.505
aromaticity		0.058
GRAVY		-0.343
Secondary Structure Fraction
Helix		0.252
turn		0.369
sheet		0.126