Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647538.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
ANAPPHEEKFLECLALNSDSDLQVYFPKTTSYTSILLSSIQNQRFASPATPKPQFIITPSHKGQVQASVICAKQHGLQIRVRSGGHDFEGLSYRSDVPFLMIDLANFDKIDVDIDDNSAW VQAGATLGQVYYKIAEKSSVHGFPAGICPTVGAGGHISGAGFGNLIRKYGVSADYVVDAILVNAKGEILNRETMGEDLFWAIRGGGAASFGIILAWKIKLVPVPTTVTVSFA | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 24,914.074 | ||
Theoretical pI: | 6.320 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 32.957 | ||
aromaticity | 0.095 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.263 | ||
sheet | 0.216 |