Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647555.1 | internal | 207 | 2-622(+) |
Amino Acid sequence : | |||
GKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHAL LAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINE | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 23,355.529 | ||
Theoretical pI: | 7.742 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
Instability index: | 26.186 | ||
aromaticity | 0.097 | ||
GRAVY | -0.390 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.188 | ||
sheet | 0.232 |