Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647584.1 | internal | 297 | 1-891(+) |
Amino Acid sequence : | |||
ATFFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYI AVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLV YRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHV | |||
Physicochemical properties | |||
Number of amino acids: | 297 | ||
Molecular weight: | 32,542.611 | ||
Theoretical pI: | 8.614 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33350 33350 | ||
Instability index: | 46.268 | ||
aromaticity | 0.098 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.303 | ||
sheet | 0.212 |