Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647620.1 | internal | 242 | 2-727(+) |
Amino Acid sequence : | |||
YFQRQETLWRQNALKTLPVLLNSSDMLSCGEDLGLIPSCVHPVMQELGLIGLRIQRMPSEPDLEFGIPSQYSYMTVCAPSCHDCSTMRAWWEEDEERRCRFYKNVVGSNDMPPSQCTPDV ARFIIRQHIESPTMWAIFPLQDLLALNEKYTTRPAAEETINDPTNPKHYWRFRIHVNMESLVEDKELTGIIKNLVKSSGRSHPHSEESYGIKEEGVNPEAVDAQKLQVSAMAQGTIPQPF PS | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 27,622.102 | ||
Theoretical pI: | 5.298 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38305 | ||
Instability index: | 66.595 | ||
aromaticity | 0.079 | ||
GRAVY | -0.488 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.252 | ||
sheet | 0.256 |