Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647623.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
EETKELYSLLNSERRAFDEIVTDFMSKFSPAVQFRACVALTDLLEDKKLLKLTQRLIAFAILHRTYSSQQLSSNPFINILVNAACDDAADKMEKVFVLQLLGSASASNSREFLKQSAVDY AKGFDPSIHVLPQREQLQKQYCDCTQPEPYNCLFRNTAVRNVVPDPDLPRGCDANSTELDFISPGGKARIGSGDRDGAVVELLQNLSLEGMSPQWIRPAPPKLSIQDAELIWLNPDNNHE LLWDYGMCADTSRGAAIRDLI | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 29,182.777 | ||
Theoretical pI: | 4.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25815 | ||
Instability index: | 54.562 | ||
aromaticity | 0.077 | ||
GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.230 | ||
sheet | 0.284 |