Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647647.1 | 5prime_partial | 215 | 1-648(+) |
Amino Acid sequence : | |||
AVHLWEVDKFDFVVCLSAFLGVVFASVEIGLVIAVALSLLRVLLFVARPRTLVLGNMPNSMIYRNIHHYPIADTLPGILILQLGAPLYFANASYLRERISRWIDEEEDKLKASGETSLRY VILDMSAVGNIDSSGLSMLDEVRKNIERRGLKMALANPGSEVVKKLEKSKKIEEIGQDWIHLTVGDAVRACYFMLHTCGPDDSKALEQESRDQNV* | |||
Physicochemical properties | |||
Number of amino acids: | 215 | ||
Molecular weight: | 24,043.646 | ||
Theoretical pI: | 5.772 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 55.926 | ||
aromaticity | 0.074 | ||
GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.205 | ||
sheet | 0.307 |