Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647655.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
VLLSRKTATKMGTSKSNKISMILLSHIFLFSISWWPSVFGQENFLQCLSLHSDQPPIPVYTPNTSSYSSILQSSIQNLRFISSVTPKPQVIITPSHESHVQAAVICCRKHGLQIRVRSGG HDYEGLSYTSDVPFVVVDLANFESIVVDVEDRSAWVQAGATIGQVYYRIAEKTSAYGFPAGGCPTVGVGGHFSAGGYGGLFRKYGLAADNIIDARIVTVDGKISDKESMGEDLFWAIRGG GGGSFGVILSWKIRLVPVH | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 28,069.729 | ||
Theoretical pI: | 8.645 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41160 | ||
Instability index: | 35.517 | ||
aromaticity | 0.100 | ||
GRAVY | 0.095 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.293 | ||
sheet | 0.170 |