Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647658.1 | internal | 270 | 1-810(+) |
Amino Acid sequence : | |||
VGFQMEDIEDLLVGSTGVAAPGLRLPFMAVGLNPKQQQQHHKADKSSNRKPNLLTQHQITSPSPEIPGTQTIYMKTFGCSHNQSDSEYMAGQLSAFGYALSNNPEEADLWLINTCTVKSP SQSAMDTLISKCKNAGKPLVVAGCVPQGSRDLKELEGVSIVGVQQIDRVVEVVEETLKGHEVRLLNRKTLPALDLPKVRKNKFIEILPINVGCLGACTYCKTKHARGHLGSYSVSSLVDR VKAVIADGVKEIWLSSEDTGAYGRDIGASL | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 29,211.115 | ||
Theoretical pI: | 7.720 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 50.321 | ||
aromaticity | 0.048 | ||
GRAVY | -0.225 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.263 | ||
sheet | 0.241 |