Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647669.1 | 3prime_partial | 268 | 46-849(+) |
Amino Acid sequence : | |||
MAQFFRRLARATSPFTFSNSFKDQTRSKLGGYRIPYGAIAAVSGGVSYFLYCSSSNMVHLDQMSEEVGPKVALNPEKWIEFKLQEKARASHNSQLFRFTFDPTAKLGLDIASCLLTRAPL GEDAEGKTKYVIRPYTPISDPEAKGYFDLLVKVYPEGKMSQHLASLKPGDIVEVKGPIEKLRYTPNMKKNIGMIAGGTGITPMLQIIEAVLKNPDDNTQLSLIYANVSPDDILLKTKLDI LASSHPNLKIFYTVDNPSKDWRGGAGYI | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 29,703.862 | ||
Theoretical pI: | 9.109 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 38.235 | ||
aromaticity | 0.097 | ||
GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.261 | ||
sheet | 0.243 |