Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647705.1 | 5prime_partial | 224 | 1-675(+) |
Amino Acid sequence : | |||
NRREVRRVYASKEPAASAGSDSRRRRAPPGVDTRIHWNNPDEGWLGVENSNRSDDDDKLKLESDEKSFLDDKFAELLNSTDSYYQFLGLSAGADLEEIKAAYRRLSKEYHPDTTSLPLKA ASDKFMKLREVYDILSNEESRRFYDWTLAQEAASRQAERLKMNLEDPYEQDVENWESIPDMVDRLGGRNMDLSDQAMTALTIDAAIIIFSICCIIYVLFLKEPY* | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 25,806.433 | ||
Theoretical pI: | 4.775 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37025 | ||
Instability index: | 49.297 | ||
aromaticity | 0.094 | ||
GRAVY | -0.714 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.210 | ||
sheet | 0.299 |