Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647710.1 | internal | 256 | 2-769(+) |
Amino Acid sequence : | |||
FFSIFFDSATMESVNAWGNAPLNQVDEEIFDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLCRSRALQVFHLDPSKWGVNVQPYSGSPAN FAAYTALLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVNSTTGYIDYDKLEEKALDFRPKLIICGGSAYPRDWDYARFRSVADKCGALLLCDMAHISGLVAAQEAAN PFEYCDVVTTTTHKSL | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 15,670.107 | ||
Theoretical pI: | 11.477 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 56.570 | ||
aromaticity | 0.035 | ||
GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.270 | ||
sheet | 0.184 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647710.1 | 5prime_partial | 141 | 769-344(-) |
Amino Acid sequence : | |||
QALVGCGCHHITILKWVGSFLSSNKTANMSHITEQQRPALIRNGPKPGVIPIPGVRTSTTYNQFGSEIQRLLLQLIIIDISSRRVHLIRQALEVNRGSRYLLPTRSVIPMSQVAARRKIQ THNPIMGVEKSRVGSEIRGTT* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,670.107 | ||
Theoretical pI: | 11.477 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 56.570 | ||
aromaticity | 0.035 | ||
GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.270 | ||
sheet | 0.184 |