Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647719.1 | internal | 278 | 1-834(+) |
Amino Acid sequence : | |||
IQKSYSTSLPPGFRFYPTDHHIFSHYLIRKNNLDLSSNSNDSCLGLDVIRETDLYNYDPCDLPEALCFPFGRGGSEKHWYCFTLNVEGREGAKRKAKGGVWKRKGRARDVLGGRQGQVLG RKMTFEFYSTCSSRLGKTNWLLVEYALVDQKKDSYALCRVFNKTSNRKKVEEHIQNSNIGSIAATRNISTDVPYKQHDGASPSGIGEVLVREDVVAESANEKHTFPLTLTGKPDGQIISG PFLSMPPPPLQLDRHAGGFKSGEVVGKDSMANEILTDS | |||
Physicochemical properties | |||
Number of amino acids: | 278 | ||
Molecular weight: | 30,934.522 | ||
Theoretical pI: | 8.793 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31775 | ||
Instability index: | 50.822 | ||
aromaticity | 0.090 | ||
GRAVY | -0.572 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.288 | ||
sheet | 0.198 |