Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647734.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
GALFCSVFLEDLLRRKKKTGKRRVMGDRIPHGSYFQYSPSGLHGHPSPHRPPSSASLDRESNGRYLAELLGERQKLGPFVQILPHCSRLLNQEIVRASGLMPSQSYVDHERIEQESPLRS TVQQTNGGPMDLEGWSVMQTEENGYLQRLGGGFQVPSMGWHGAPGVANSSVVKKVIRLDVPVDKFPSYNFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKDSVKEEKLRDKPGYEHLN EPLHVLVEAEFPA | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 28,265.828 | ||
Theoretical pI: | 9.462 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 47.864 | ||
aromaticity | 0.071 | ||
GRAVY | -0.589 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.300 | ||
sheet | 0.229 |