Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647751.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
LFNCIISTSKSKMADTRDIEPFLIDKKRRGTDDLDREDRMVLKKSATSPVALYDDPAAALANARHEFGEHGGVNMSIEASATFTVMEPETMSRMFNGELGPERDFFIYSRHFNPTVLNFS RLMAALEGTEAAYCTASGMSAISSVLMQLCSSGGHVVASQTLYGGTHALLTHFLPRACNITTTFVDVRDMETVNDAMVEGKTKVLYVESMSNPTLTVANVPELC | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 12,926.663 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 102.933 | ||
aromaticity | 0.065 | ||
GRAVY | -1.038 | ||
Secondary Structure Fraction | |||
Helix | 0.234 | ||
turn | 0.178 | ||
sheet | 0.150 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647751.1 | 5prime_partial | 107 | 674-351(-) |
Amino Acid sequence : | |||
AQLRHVSNSQRRIRHRFHVQHLRFPFHHRIVHRLHVPHVHERRRYVTSPRQKMSQQSVSPSVKCLRCHHVSPAAAQLHQNRRYGRHPARRAVRRFGAFQSRHQTAEI* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,926.663 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 102.933 | ||
aromaticity | 0.065 | ||
GRAVY | -1.038 | ||
Secondary Structure Fraction | |||
Helix | 0.234 | ||
turn | 0.178 | ||
sheet | 0.150 |