Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647759.1 | 3prime_partial | 240 | 57-776(+) |
Amino Acid sequence : | |||
MGKCYPTVSDEYQQAVEKCRKKLRGLIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTMKHASELAHGANNGLDIAVRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPEIPFHPGRE DKSVPPPEGRLPDATKGTDHLRQVFVHQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWTFNPLIFDNSYFKELLSGEKEGLLQLPTDKVLLEDPVFCPLVKKYAADEDAFFKDYTEAHL | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 26,571.989 | ||
Theoretical pI: | 5.853 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
Instability index: | 32.118 | ||
aromaticity | 0.092 | ||
GRAVY | -0.366 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.229 | ||
sheet | 0.271 |