Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647760.1 | 3prime_partial | 159 | 248-724(+) |
Amino Acid sequence : | |||
MKPGFDPSKGGRPEFYFEEGSYPEQVDWIGQKNQIEAAKNAGVKQIVLVGSMGGTNPNHPLNSLGNGNILVWKRKAEQYLADSGIPYTIIRAGGLQDKEGGVRELLVGKDDELLQLDTRS IAREDVAEVCIQALQFEEAKFKAFDLASKPEGAGEPTKD | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 17,349.291 | ||
Theoretical pI: | 4.941 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 37.969 | ||
aromaticity | 0.075 | ||
GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.264 | ||
sheet | 0.270 |