Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647764.1 | 5prime_partial | 233 | 1-702(+) |
Amino Acid sequence : | |||
LILPTKIMIITFPSFLIFSITLASFLFCVANAATFEVTNNCGYPVWAAAVPGGGQLLNQGETWRFDVNPGTTQARIWGRTGCNFDGNGRGRCQTGDCNGLLRCEAYGQPPNTLAEYALNQ FGNMDFFDISLVDGFNIPMEFSPTTGNCRGIKCNADINGQCPNELKTDGGCHNPCTVFKTDEYCCNSGNCGPTPLSKFFKERCPDAYSYPKDDPTSTFTCPAGTNYKVVFCPA* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 25,331.394 | ||
Theoretical pI: | 4.984 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27930 | ||
Instability index: | 16.967 | ||
aromaticity | 0.120 | ||
GRAVY | -0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.305 | ||
sheet | 0.172 |