Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647765.1	internal	107	1-321(+)
Amino Acid sequence :
DFLMAVSLESLSEATSGAIGALLSTTILYPLDTCKTKYQAEVRARGQQKYRNLSDVLFEAISKKQILSLYQGLGTKNLQSFISQFIYFYGYSYFKRLYLRKSGSKSI
Physicochemical properties
Number of amino acids:		107
Molecular weight:		12,131.848
Theoretical pI:		9.607
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13410 13410
Instability index:		30.863
aromaticity		0.140
GRAVY		-0.095
Secondary Structure Fraction
Helix		0.374
turn		0.224
sheet		0.252