Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647772.1	internal	248	3-746(+)
Amino Acid sequence :
DGTRMSFSAKHILIATGSRAHRPAIPGMELAITSDEALSLEELPKRAVVLGGGYIAVEFASIWRGMGATVDLFYRKELPLRGFDNEMRTVVAKNLEGRGIKLHPGTNLKELAKTEGGIKV LTDNGEELIADVVLFATGRAPNTKRLNLQAVGVELDKIGAVKVDEYSRTNIPSIWAVGDVTNRVNLTPVALMEGTCFAKTVFGGQPTKPDYRDIPCAVFCIPPLSVVGLSEEQAVEQAKG DILIFTST
Physicochemical properties
Number of amino acids:		248
Molecular weight:		10,572.322
Theoretical pI:		10.453
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		49.812
aromaticity		0.090
GRAVY		0.560
Secondary Structure Fraction
Helix		0.340
turn		0.370
sheet		0.250

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647772.1	complete	100	523-221(-)
Amino Acid sequence :
MLGMLVREYSSTFTAPILSSSTPTACKFNLFVLGARPVANSTTSAINSSPLSVRTLIPPSVLANSFKFVPGCNLMPLPSRFFATTVLISLSKPLSGSSFL*
Physicochemical properties
Number of amino acids:		100
Molecular weight:		10,572.322
Theoretical pI:		10.453
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		49.812
aromaticity		0.090
GRAVY		0.560
Secondary Structure Fraction
Helix		0.340
turn		0.370
sheet		0.250