Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647795.1	internal	247	3-743(+)
Amino Acid sequence :
TSDNFLSYQLTFEMSNQAESSDSKGAKRDFSTAILERKKAANRLVVDEAINDDNSVVALHPDTMDKLQLFRGDTILIKGKKRRDTICIALADETCEEPKIRMNKVVRTNLRVRLGDVVSV HQCPNVKYGKRVHILPVDDTIEGVSGNLFDAYLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVRREDEERLDEVGYDDVGGVRKQMAQIRELVELP LRHPQLF
Physicochemical properties
Number of amino acids:		247
Molecular weight:		13,497.665
Theoretical pI:		10.151
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		47.442
aromaticity		0.089
GRAVY		0.438
Secondary Structure Fraction
Helix		0.347
turn		0.266
sheet		0.250

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647795.1	complete	124	424-50(-)
Amino Acid sequence :
MVSSTGSICTRFPYLTLGHWWTETTSPSLTRKLVRTTLFILIFGSSQVSSARAMQIVSLLFLPLIKIVSPRKSCNLSIVSGCKATTELSSLIASSTTSRFAAFLRSKIAVLKSLFAPFES EDSA*
Physicochemical properties
Number of amino acids:		124
Molecular weight:		13,497.665
Theoretical pI:		10.151
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		47.442
aromaticity		0.089
GRAVY		0.438
Secondary Structure Fraction
Helix		0.347
turn		0.266
sheet		0.250