Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647806.1 | internal | 278 | 1-834(+) |
Amino Acid sequence : | |||
GKMSLSLLASVSASSLTQKKPLQGAKTPAIPNRCGSKQARFISCEKKQGGEHGHENHVIDRRNVLLGIGGLYGATATIGSQGKVAIGAPVQPPDLSKCHLALDSDAGQEVNCCPPYSTAN IIDFVPPSHDERLRRRKPAHMLNPEEIEKFKTAIAKMKALDKDDPWNFMQQATIHCTYCNGAFDQVGFPETLLQVHGSWLFLPWHRYYLYFWERILGKLIGDDTFAIPYWNWDNPEGMRM PEFYLDKMSPLYNDNRNHNHYNALMDYDYSIGDPNPTP | |||
Physicochemical properties | |||
Number of amino acids: | 278 | ||
Molecular weight: | 31,321.228 | ||
Theoretical pI: | 6.890 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51255 | ||
Instability index: | 52.534 | ||
aromaticity | 0.101 | ||
GRAVY | -0.528 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.270 | ||
sheet | 0.230 |