Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647809.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
YRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSY PPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNL INHVRNGTPKRPG | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 28,030.368 | ||
Theoretical pI: | 9.421 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31860 | ||
Instability index: | 45.984 | ||
aromaticity | 0.099 | ||
GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.320 | ||
sheet | 0.182 |