Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647809.1	internal	253	3-761(+)
Amino Acid sequence :
YRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSY PPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNL INHVRNGTPKRPG
Physicochemical properties
Number of amino acids:		253
Molecular weight:		28,030.368
Theoretical pI:		9.421
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31860 31860
Instability index:		45.984
aromaticity		0.099
GRAVY		-0.258
Secondary Structure Fraction
Helix		0.336
turn		0.320
sheet		0.182