Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647816.1 | internal | 251 | 2-754(+) |
Amino Acid sequence : | |||
VGFPETLLQVHGSWLFLPWHRYYLYFWERILGKLIGDDTFAIPYWNWDNPEGMRMPEFYLDKMSPLYNDNRNHNHYNALMDYDYSIGDPNPTPGQEEMVILNNLRQVYNMYTEGLAKPSL FMGGPLRAGEKVSEAAGRLETMHNLAHQWTGPEAVPYHDMGNFYSAARDTMFFGHHANVDRLWDLYSTLRGHKVEFNDPDWLNASFIFYDENRQVVKVKVKDCIDVENLGYSYKSEKHFW KDIRKRYKDVI | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 29,740.178 | ||
Theoretical pI: | 5.749 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 76320 76320 | ||
Instability index: | 40.607 | ||
aromaticity | 0.159 | ||
GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.235 | ||
sheet | 0.235 |