Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647824.1 | internal | 241 | 2-724(+) |
Amino Acid sequence : | |||
AATILEKKYGPCWEPEASEIPKRKGRKAKASHEDKMYRCECLEPMWPSRHHCLLCHQTFSSPVELEGHNDGKCSSGSLIPDESKENDDPLKGKGLIRSEGIQEACSDEAVVEASTIGKLD ISTRLIKFHKKEMVCPYSVEDIGSKFIIKNSNKELVQEIGLIGSNGIPSFVPVSSPYVHDQTLSLSPAERADIRPGSSAIDGALLLGNRTPLSTEKNNLTQLSSGQRAGDIHESSKADLP K | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 26,321.482 | ||
Theoretical pI: | 6.101 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17460 | ||
Instability index: | 48.710 | ||
aromaticity | 0.041 | ||
GRAVY | -0.566 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.295 | ||
sheet | 0.249 |